PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30653.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 342aa    MW: 38876.1 Da    PI: 4.4646
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30653.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde l+++++  G g+W++ ++  g+ R++k+c++rw +yl
       KHN30653.1 14 KGRWTAEEDETLAKYIQTNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+  +v++++ +G++ W++Ia++++ gRt++++k++w+++l
       KHN30653.1  67 RGNISAEEENTIVKLHASFGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.358961IPR017930Myb domain
SuperFamilySSF466897.19E-2811108IPR009057Homeodomain-like
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
PfamPF002495.2E-151461IPR001005SANT/Myb domain
CDDcd001673.77E-81661No hitNo description
PROSITE profilePS5129425.44362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002496.6E-1567112IPR001005SANT/Myb domain
CDDcd001671.07E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDETLAKYIQ TNGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SAEEENTIVK LHASFGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIYSFP  120
GASAGIMDTP KVASIPPKLK GGRTSRWAMN KNKTYTQNVN DAINQRPKQT FTQPNSDFTV  180
LDADVADVNE PRIEELEAEV NKCDRSVDES NDEDILGLCQ MEGISDILES WLPETTCVVW  240
DLSEEIDNND MVVRVSDACR DKMASSGEGY SCSSSMALDQ HWDWESVIEF NNVVESEACN  300
NWEQQEKPLT WPWEDDAWES QSKNLGETDT QMQNDMVDWF LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934630.0BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001276129.10.0uncharacterized protein LOC100793350
SwissprotO222644e-74MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0B2RFI00.0A0A0B2RFI0_GLYSO; Transcription factor MYB12
STRINGGLYMA10G01801.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.17e-76myb domain protein 111
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]